<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ERRJ04 PROERRJ04 Brazil 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI NA
2 3TC+AZT+SQV NA
3 3TC+D4T+RTV+SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12E, L19I, N37C, L63T  
>PROERRJ04| codons 1-99
PQITLWQRPLVEIKIGGQIKEALLDTGADDTVLEEMCLPGRWKPKMIGGIGGFIKVRQYD
QITIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Caride, E Genotypic and phenotypic evidence of different drug-resistance mutation patterns between B and non-B subtype isolates of human immunodeficiency virus type 1 found in Brazilian patients failing HAART. Virus Genes, 2001