<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
337 MT000337 Mozambique 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        M16MT, K20KR, V35T, T39E, V118I, K122E, D123S, I135T, T165I, K166R, K173T, Q174R, I178L, T200A, Q207E, R211K, F214L, V245Q, E248DN, A272P, K275R, K277R, Q278N, T286A, E291D, V292I, I293V  
>MT000337| codons 1-320
PISPIETVPVKLKPGTDGPRVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIRILEPFRTRNPDLVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNWASQIYPGIRVRNLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, E35D, M36I, R41K, K45R, D60E, H69K, L89M, I93L  
>MT000337| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVRQYE
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Bellocchi, MC Subtype analysis and mutations to antiviral drugs in HIV-1-infected patients from Mozambique before initiation of antiretroviral therapy: Results from the DREAM programme. J Med Virol, 2005