<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
879 MT000879 Mozambique 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12A, I15V, L19IV, K20R, N37S, R41K, L63S, H69K, K70Q, V77I, L89M, I93L  
>MT000879| codons 1-99
PQITLWQRPLVAIKVGGQVREALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGKQAIGTVLIGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6K, V35T, E36A, T39E, S48T, K122E, D123GS, K166T, K173A, D177E, T200A, E204K, Q207D, R211K, V245Q, D250NS, A272P, K277R, T286A, E291D, V292I, I293V  
>MT000879| codons 1-320
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTTILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEKLRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKSSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYD

References
Author Title Citation
Bellocchi, MC Subtype analysis and mutations to antiviral drugs in HIV-1-infected patients from Mozambique before initiation of antiretroviral therapy: Results from the DREAM programme. J Med Virol, 2005