<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
71K 610471K-48 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA
2 3TC+AZT+RTV 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A K43T I15V, E35D, N37S, R41K, F53I, D60E, L63P  
>610471K-48| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDMSLPGKWTPKMIGGIGGIIKVRQYE
QIPIEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q     K20R, K64H, I135V, I202V, L228H, T286A  
>610471K-48| codons 1-297
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIHKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLRWGFFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTE

References
Author Title Citation
Weber, J Role of baseline pol genotype in HIV-1 fitness evolution. JAIDS, 2003