<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
5W IRIS5W-48 Belgium 1998 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L5F, I13V, E35D, M36I, R41K, R57K, H69K, L89M  
>IRIS5W-48| codons 1-99
PQITFWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       P4T, K11T, V21I, V35T, E40D, K49R, V60I, V90I, K122E, D123S, I135T, K173S, D177E, T200A, Q207A  
>IRIS5W-48| codons 1-220
PISTIETVPVTLKPGMDGPKIKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLRWGFTTPDKK

References
Author Title Citation
Weber, J Role of baseline pol genotype in HIV-1 fitness evolution. JAIDS, 2003