<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
3M IRIS3M-24 Belgium 1998 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA
2 D4T+RTV+SQV 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, H69K, L89M  
>IRIS3M-24| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6K, K11T, V35T, T39E, K122E, D123S, S162C, K173S, D177E, T200A, I202V, Q207A, R211S  
>IRIS3M-24| codons 1-220
PISPIKTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRSQNPEIVI
YQYMDDLYVGSDLEIGQHRAKVEELRAHLLSWGFTTPDKK

References
Author Title Citation
Weber, J Role of baseline pol genotype in HIV-1 fitness evolution. JAIDS, 2003