<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1C IRIS1C-48 Belgium 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA
2 3TC+D4T+IDV 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K43R, I62V, L63P, A71T, V77I, I93L  
>IRIS1C-48| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWRPKMIGGIGGFIKVRQYD
QVPIEICGHKTIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        A158S, I178M, Q207H, R211K  
>IRIS1C-48| codons 1-220
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEELRHHLLKWGFTTPDKK

References
Author Title Citation
Weber, J Role of baseline pol genotype in HIV-1 fitness evolution. JAIDS, 2003