<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
21042 21042PR243 Israel 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, M36I, R41K, L63I, I64V, H69K, I72IV, L89M, I93L  
>21042PR243| codons 4-99
TLWQRPLVTVKVGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQII
VEICGKKAVGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39D, S48T, K82R, A98S, K122E, D123S, I135R, A158AS, T165TI, K173A, D177E, T200A, I202V, Q207E, R211RK, V245Q  
>21042RT243| codons 38-247
CDEMEKEGKITKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNRRTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSP
SIFQSSMIKILEPFRAQNPEIVIYQYMDDLYVGSDLEIGQHRAKVEELREHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Grossman, Z Drug-resistant HIV infection among drug-naive patients in Israel. Clin Infect Dis, 2005