<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
M22860 UG_M22860 Uganda 2002 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TA, I13V, K14KR, I15LV, L19I, N37NHRS, R41K, I64V, H69Y, V77I  
>UG_M22860| codons 4-99
TLWQRPLVAVRVGGQIKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVRQYDQIL
VEICGYKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K49R, V60I, K173T, D177E, I178IMV, V189I, T200I, Q207G, R211K, V245K K166K*
>UG_M22860| codons 38-247
CTEMEKEGKISRIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMT*ILEPFRTQNPEVVIYQYMDDLYIGSDLEIGQHRIKIEELRGHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Galluzzo, CM Antiretroviral resistance mutations in untreated pregnant women with HIV infection in Uganda and Rwanda. ARHR, 2007