<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
23610 RW_23610 Rwanda 2001 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, H69K, L89M  
>RW_23610| codons 4-99
TLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39E, E40D, E53D, K122E, D123G, K173A, Q174R, D177E, T200E, Q207A, R211S, F214L, L228M, V245E  
>RW_23610| codons 38-247
CEDMEKEGKISKIGPDNPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRARNPEIVIYQYMDDLYVGSDLEIGQHREKIEELRAHLLSWGLTTP
DKKHQKEPPFMWMGYELHPDKWTVQPIELP

References
Author Title Citation
Galluzzo, CM Antiretroviral resistance mutations in untreated pregnant women with HIV infection in Uganda and Rwanda. ARHR, 2007