<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1620 CA14523 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 130
2 NRTI 286
3 D4T+ 3TC 56
4 IDV+ NVP+ 3TC 60
5 None 45
6 SQV+ RTV+ NVP+ AZT+ 3TC 19
7 EFV+ ABC+ 3TC 54

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y   G190S   T39D, A158S, S162C, V189I, L246LV  
>CA14523| codons 1-254
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICDELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYISSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVVPEKDSWTV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63P  
>CA14629| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005