<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RENA249 RENA249 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 22
2 3TC+AZT 122
3 D4T+DDI+NVP 4
4 D4T+DDI+NFV 159

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I N88G L10V, I15V, K20T, E35D, M36I, R41K, R57K, L63P, H69K, A71V  
>RENA249| codons 1-99
PQITLWQRPVVTIKVGGQLTEALLDTGADDTVLEDINLPGKWKPKIIGGIGGFIKVKQYD
QIPIEICGKKVIGTVLVGPTPVNIIGRGLLTQIGCTLNF

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009