<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RENA818 RENA818 Brazil 2004 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 74
2 Unknown 4
3 AZT+DDI+IDV 122
4 Unknown 4
5 3TC+D4T+EFV 191

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12M, I15V, L19S, E35D, M36I, R57K, Q61N, L89M  
>RENA818| codons 1-99
PQITLWQRPLVMIKVGGQSKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYD
NILIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009