<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RENA332 RENA332 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 56
2 3TC+D4T+IDV 96
3 AZT+DDI+RTV+SQV 65
4 3TC+AZT+IDV+NFV+RTV 74

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219EQ Y181C V179D K20R, V90I, K102Q, K103R, D123E, I135V, S162C, E169D, K173A, Q174K, T200A, Q207E, R211K, F214L, V245Q, E248D, A272P, A288T, E291D, V292I, I293V, E297A, V317A  
>RENA332| codons 1-335
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKQRKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPDIDI
CQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKTLTDIVPLTAEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M   L10V, K20R, E35D, M36I, R41K, D60E, Q61D, I62V, L63P, H69Y, I72T, L89M  
>RENA332| codons 1-99
PQITLWQRPVVTIKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYE
DVPIEICGYKATGTVLVGPTPVNVIGRNMMTQIGCTLNF

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009