<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RENA244 RENA244 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+RTV 69
2 3TC+D4T+RTV+SQV 44
3 3TC+D4T+IDV 52
4 3TC+AZT+NFV+NVP 30
5 3TC+AZT+EFV 39
6 Unknown 65

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, V75M, T215F K219Q K103N, G190A   E6D, V35T, V60I, V90I, K102N, S117A, D121H, K122E, I135T, S162Y, E169D, P170L, F171Y, Q174K, D177E, G196E, T200A, E203D, Q207E, L228H, V245Q, D250E, A272P, T286A, E291D, V292I, I293V, E297A, V317A  
>RENA244| codons 1-335
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLMDFRELNKRTQDFWEIQLGIPHPAGLKNNKSVTVLDVGDAYFAVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILDLYRKKNPEIVI
YQYMDDLYVASDLEIEQHRAKIDELREHLLRWGFFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, L76V, V82A, L90M   L10V, I15V, K20R, E34A, E35D, M36I, R41K, R57K, D60E, Q61D, I62V, L63P, A71V, I93M  
>RENA244| codons 1-99
PQITLWQRPVVTIKVGGQLREALLDTGADDTVLADINLPGKWKPKIIGGVGGFIKVKQYE
DVPIEICGHKVIGTVVVGPTPANIIGRNLMTQMGCTLNF

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009