<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RENA181 RENA181 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 22
2 3TC+AZT+IDV 17
3 3TC+D4T+IDV 196
4 AZT+DDI+EFV 82

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, T215Y   L100LI, K101E, K103N   K20R, V35T, K49R, V106I, K122E, I135V, E138A, S162C, E169D, Q174K, D177Q, I178L, V179I, Q207D, R211K, L228LR, V245Q, E248D, A272P, K277R, T286A, A288T, E291D, V292I, I293V, E297A, V317A  
>RENA181| codons 1-335
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTELEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIEKNKSITVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKKNPQLII
YQYMDDLYVGSDLEIGQHRTKIEELRDHLLKWGFYTPDKKHQKEPPFRWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKTLTDIVPLTAEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I L10I, I15V, E35D, M36I, P39T, R41K, K55R, R57K, D60E, Q61D, I62V, L63P, A71V, L89I, I93L  
>RENA181| codons 1-99
PQITLWQRPIVTIKVGGQLKEALIDTGADDTVLEDINLTGKWKPKLIGGIGGFVRVKQYE
DVPIEICGHKVIGTVLVGPTPANIIGRNILTQLGCTLNF

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009