<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RENA626 RENA626 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 31
2 3TC+D4T+RTV+SQV 22
3 3TC+AZT+NFV+NVP 122
4 D4T+DLV+IDV+RTV 82
5 ABC+DDI+LPV 78

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, L210W, T215Y V75S, K219E K103N A98G, V108I E6K, K20R, K32R, V35T, T39A, E44D, V118I, K122E, E138G, S162Y, E169D, K173A, Q174K, T200A, E203K, Q207E, H208Y, W212M, K223E, F227FY, L228H, Q242H, V245Q, E248D, A272P, K277R, L283I, T286A, E291D, V292I, I293V, E297T, D324E, Q334E  
>RENA626| codons 1-335
PISPIKTVPVKLKPGMDGPRVKQWPLTEEKIRALTEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTRWRKISDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSINNGTPGIRYQYNVLPQGWKGSPAIFQYSMTKILDPFRAKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIKELREYLWRMGFYTPDEKHQEEPPYHWMGYELHPDKWT
VHPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGAKALTDIVPLTTEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGEG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I50V, I54V, V82T, L90M K43T, L89V L10I, T12N, I15V, L19P, K20R, E21Q, E35D, M36I, N37D, K55R, R57K, Q61N, L63P, A71V, I72V, I85V, Q92K  
>RENA626| codons 1-99
PQITLWQRPIVNIKVGGQPRQALLDTGADDTVLEDIDLPGRWTPKLIGGVGGFVRVKQYD
NIPIEICGHKVVGTVLVGPTPTNIVGRNVMTKIGCTLNF

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009