<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RENA140 RENA140 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 91

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215FY K219E     E28K, V35T, K122Q, I135V, S162C, E169D, K173T, Q174K, I178L, T200A, I202V, Q207A, R211Q, V245Q, E248D, A272P, T286A, A288T, E291D, V292I, I293V, E297A, I329L  
>RENA140| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DQDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRTKNPDLVI
YQYVDDLYVGSDLEIGQHRAKVEELRAHLLQWGFYTPDEKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKTLTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D L10I, I13V, I15V, E35D, M36I, R41K, R57K, Q61D, L63C, K70R, I72T, L89M  
>RENA140| codons 1-99
PQITLWQRPIVTVKVGGQLKEALLDTGADNTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
DICIEICGHRATGTVLVGPTPVNIIGRDMLTQIGCTLNF

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009