<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RENA446 RENA446 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+RTV 13
2 3TC+AZT+RTV 17
3 3TC+D4T+NFV 35
4 Unknown 26
5 ABC+APV+EFV 83
6 ABC+D4T+DDI+RTV+SQV 57

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, I84IV   L10I, G17D, L19I, K20R, E35D, M36I, K55R, Q61D, L63T, E65D, I72T, T74S, L89M  
>RENA446| codons 1-99
PQITLWQRPIVTIKIGDQIREALLDTGADDTVLEDINLPGRWKPKMIGGIGGFVRVRQYD
DITIDICGHKATGSVLVGPTPANVIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74I, T215F V75T, K219E Y181C   V35T, T39S, K101Q, D121H, K122E, S162C, K173T, Q174K, I178L, T200A, Q207E, R211K, D218DE, L228LH, V245Q, E248D, A272P, T286A, E291D, V292I, I293V, E297A, Q334N  
>RENA446| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICSEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKITDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTKNPDLVI
CQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFFTPEEKHQKEPPFHWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGNG

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009