<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
75PR 75PR Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 104

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54A, V82T K43T L10I, K20R, E35D, M36I, R41K, R57K, D60E, Q61N, L63E, E65D, I72V, L89M, I93L  
>75PR| codons 3-99
ITLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGKWTPKMIVGIGGFAKVKQYENI
EIDICGHKAVGTVLVGPTPTNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, L210W, T215F K219W     P4S, V35T, T39M, K43Q, S162C, E169D, K173A, Q174K, I178L, I202V, Q207E, H208Y, R211K, K223Q, L228R  
>75PR| codons 1-240
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMELEQEGKISKIGPENPYNTPV
FAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPDLVI
YQYMDDLYVGSDLEIGQHRTKVEELREYLWKWGFFTPDWKHQQEPPFRWMGYELHPDKWT

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009