<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RES222_03 RES222_03 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 165
2 Unknown 4
3 D4T+DDI+EFV 48
4 Unknown 4

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10V, I15V, L19I, K20T, E35D, M36I, R41K, R57K, Q61N, L63A, T74S, I93L  
>RES222_03| codons 5-98
LWQRPVVTIKVGGQITEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDNIAI
EICGHKAIGSVLVGPTPVNIIGRNLMTQLGCTLN

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009