<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RES153_02 RES153_02 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+IDV+RTV 39

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, V82A, L90M   L10I, T12P, I15V, G16E, K20R, E34A, E35D, M36I, R41K, R57K, Q61N, L63T, E65D, A71V, I72T, T74S, I93L  
>RES153_02| codons 5-98
LWQRPIVPIKVEGQLREALLDTGADDTVLADINLPGKWKPKMIVGIGGFTKVKQYDNITI
DICGHKVTGSVLVGPTPANIIGRNLMTQLGCTLN

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009