<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RES304_03 RES304_03 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT 100
2 AZT+DDI+IDV 91
3 3TC+D4T+NFV 74
4 3TC+D4T+EFV+NFV 100
5 D4T+DDI+LPV 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I L10I, K20R, A22AV, E35D, M36I, R41K, K55R, R57K, Q61N, I62V, L63P, A71V, Q92K  
>RES304_03| codons 5-98
LWQRPIVTIKIGGQLREVLIDTGADDTVLEDINLPGKWKPKLIGGIGGFVRVKQYDNVPI
EICGHKVIGTVLVGPTPANIIGRNLLTKIGCTLN

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009