<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RES28_02 RES28_02 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 17
2 AZT+DDI 48
3 3TC+AZT+IDV 87
4 3TC+AZT+NVP 43
5 D4T+DDI+NFV 30
6 APV+D4T+EFV+RTV 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L33F L10I, G17D, K20R, E35D, M36I, R41K, R57K, Q61N, L63V, E65D, L89M  
>RES28_02| codons 5-98
LWQRPIVTIKIGDQLREALLDTGADDTVFEDINLPGKWKPKLIGGIGGFVKVKQYDNIVI
DICGHKAIGTVLVGPTPANIIGRNMLTQIGCTLN

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009