<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RENA749 RENA749 Brazil 2004 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 204
2 Unknown 4
3 3TC+AZT+RTV 121
4 Unknown 4
5 3TC+AZT+NFV 48
6 Unknown 17
7 D4T+DDI+EFV 87
8 Unknown 4
9 3TC+DDI+IDV+RTV 43
10 Unknown 57

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I15V, G16E, K20R, E35D, M36I, P39S, R41K, R57K, Q61N, I62V, L63P, I64M, H69Q, L89M  
>RENA749| codons 1-99
PQITLWQRPIVTIKVEGQLREALLDTGADDTVLEDINLSGKWKPKMIGGIGGFIKVKQYD
NVPMEICGQKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009