<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RENA502 RENA502 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 104
2 3TC+AZT+IDV 57
3 3TC+D4T+RTV+SQV 74
4 D4T+DDI+IDV+NFV 113
5 3TC+DDI+EFV 78

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, V82A   L10V, I15V, K20R, E35D, M36I, R41K, K55R, R57K, D60E, Q61D, I62V, L63P, L89M  
>RENA502| codons 1-99
PQITLWQRPVVTIKVGGQLREALLDTGADDTVLEDINLPGKWKPKLIGGIGGFIRVKQYE
DVPIEICGHKAIGTVLVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, L74V, M184V, T215Y K70S L100I, K103N   E6D, K20R, V35M, K49R, K122E, D123E, I135T, E169A, K173A, Q174K, I178L, Q207E, R211K, V245Q, E248D, A272P, T286A, E291D, V292I, I293V, E297A, V317A P97PS, A129AV, P150PS
>RENA502| codons 1-335
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTEMEKEGKISRIGPENPYNTPV
FAIKKKNSTSWRKVVDFRELNKRTQDFWEVQLGIPHSAGIKKNKSVTVLDVGDAYFSVPL
DEEFRKYTVFTIPSTNNETPGIRYQYNVLSQGWKGSPAIFQSSMTKILAPFRAKNPDLVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009