<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RENA254 RENA254 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 9
2 3TC+AZT 96
3 D4T+DDI+IDV 30
4 DDI+IDV+NFV+NVP 13
5 AZT+DDI+IDV+NFV 57
6 Unknown 113

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A   L10V, I15V, K20R, E35D, M36I, R41K, R57K, Q61N, I62V, T74S, L89M  
>RENA254| codons 1-99
PQITLWQRPVVTIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NVLIEICGHKAIGSVLVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D K219Q     E6D, K20R, V35T, T39A, E40D, V60I, K101Q, K122E, S162H, E169D, K173A, Q174K, T200A, Q207G, R211K, V245Q, E248D, A272P, T286A, E291D, V292I, I293V, E297T, V317A  
>RENA254| codons 1-335
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALTEICADMEKEGKISKIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILDPFRAKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRGHLLKWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTTEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009