<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RENA511 RENA511 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 4
2 AZT+DDC 4
3 3TC+AZT 91
4 3TC+AZT+RTV 22
5 AZT+DDI+IDV 39
6 Unknown 196

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S   L10V, I13V, I15V, K20R, E35D, M36I, N37T, R41K, K45R, R57K, Q61N, I62V, E65D, I72V, L89M  
>RENA511| codons 1-99
PQITLWQRPVVTVKVGGQLREALLDTGADDTVLEDITLPGKWKPRMIGGIGGFIKVKQYD
NVLIDICGHKAVGTVLVGPTPVNIIGRSMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y   K101P, K103N   E6D, K20R, E28K, K32E, V35M, T39A, I132V, I135V, S162Y, K173T, Q174K, D177E, T200A, Q207E, R211K, V245Q, E248N, A272P, T286A, E291D, V292I, I293V, E297A, G333E  
>RENA511| codons 1-335
PISPIDTVPVKLKPGMDGPRVKQWPLTKEKIEALMEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLPKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTVPSVNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEQG

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009