<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
470_05 470_05 Brazil 2005 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L89V L10V, I13V, G17D, K20R, E35D, M36I, R41K, R57K, Q61N, E65D, I72T  
>470_05| codons 1-97
PQITLWQRPVVTVKIGDQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NILIDICGHKATGTVLVGPTPVNIIGRNVLTQIGCTL

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009