<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RENA596 RENA596 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+IDV 231
2 Unknown 4
3 3TC+AZT+NFV 48
4 3TC+AZT+LPV 43

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A   L10V, I15V, E35D, M36I, R41K, R57K, Q61N, I72T, L89M  
>RENA596| codons 1-99
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKLIGGIGGFVKVKQYD
NILIEICGHKATGTVLVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V       V35T, T39M, K49R, I135T, E169D, K173A, Q174K, T200A, R211K, A272P, K281R, V292I, E297K  
>RENA596| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMEMEKEGKISRIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRAKNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEIIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009