<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RENA555 RENA555 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+SQV 104
2 3TC+D4T+NFV 4
3 3TC+D4T+RTV 57
4 3TC+AZT+IDV+RTV 4
5 3TC+AZT+NFV 22
6 Unknown 143

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L33F, K43T, F53L, T74P L10V, I13V, K14R, G16E, K20R, E35D, M36I, P39T, R41K, R57K, D60E, Q61N, I62V, L63H, A71I, I72V, I93L  
>RENA555| codons 1-99
PQITLWQRPVVTVRIEGQLREALLDTGADDTVFEDINLTGKWTPKMIGGIGGLVKVKQYE
NVHIEICGHKIVGPVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210W, T215Y K219E     V35T, T39M, V60I, K122E, I135T, S162Y, E169D, K173A, Q174K, V179I, Q207R, H208Y, R211K, K223Q, L228H, Q242H, A272P, K277R, K281R, I293V, E297K  
>RENA555| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILDPFRAKNPDIII
YQYMDDLYVGSDLEIGQHRTKIEELRRYLWKWGFYTPDEKHQQEPPFHWMGYELHPDKWT
VHPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCRLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009