<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RENA133 RENA133 Brazil 2002 HIV1 CRF12_BF Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 104
2 3TC+D4T 17
3 3TC+D4T+NFV+SQV 70
4 AZT+DDI+IDV+RTV 9
5 D4T+DDI+EFV+NFV 91

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   K103N, G190S   V35T, T39R, K43E, T58TS, W88C, V118I, D123E, I135L, S162Y, E169D, K173A, Q174K, T200A, R211S, V245K, A272P, K281R, E297R P97PS, P226PS
>RENA133| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICRELEEEGKISKIGPENPYNSPV
FAIKKKDSTKWRKLVDFRELNKRTQDFCEVQLGIPHSAGLKKNKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILDPFRAKNPDIVI
YQYMDDLYVSSDLEIGQHRAKIEELRQHLWSWGFYTPDKKHQKEPSFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEVIPLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M F53L L10I, I15V, K20R, E35D, M36I, R41K, K55R, R57K, D60E, Q61N, L63P, A71V  
>RENA133| codons 1-99
PQITLWQRPIVTIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGLVRVKQYE
NIPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009