<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RENA162 RENA162 Brazil 2002 HIV1 CRF12_BF Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+SQV 100
2 D4T+DDI+SQV 65
3 D4T+DDI+NFV 52
4 3TC+AZT+IDV 43
5 3TC+AZT+EFV 35

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, T69D, T215F   K103N, Y181C, G190A   K20R, V35T, V90I, S162H, E169D, K173A, Q174K, V179I, G196E, R211K, L228R, A272P, K281R, T286V, I293V, E297K, Q334L  
>RENA162| codons 1-335
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSDKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILDPFRAKNPDIII
CQYMDDLYVASDLEIEQHRTKIEELRQHLLKWGFFTPDKKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGVKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGLG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, E35D, M36I, R41K, D60E, Q61N, I62V, L63T, C67D, T74S, V77I, L89M  
>RENA162| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYE
NVTIEIDGHKAIGSVLIGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009