<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RENA654 RENA654 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+RTV 113
2 3TC+AZT+NFV 100
3 3TC+D4T+NFV 52
4 D4T+DDI+EFV+LPV 91

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M   L10V, I15V, K20R, E35D, M36V, N37E, R57K, D60E, Q61D, I62V, A71V, I72T, V77I, I93L  
>RENA654| codons 1-99
PQITLWQRPVVTIKVGGQLREALLDTGADDTVLEDVELPGRWKPKLIGGIGGFVKVKQYE
DVLIEICGHKVTGTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215F   L100I, K103N   V35T, K43N, I135V, E169D, K173A, Q174K, I178L, G196E, Q207A, R211K, L228R, P243S, A272P, K277R, T286A, E291D, V292I, I293V, E297A  
>RENA654| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELENEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRAKNPDLVI
YQYMDDLYVGSDLEIEQHRTKIEELRAHLLKWGFFTPDKKHQKEPPFRWMGYELHPDKWT
VQSIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009