<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RENA276 RENA276 Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 13
2 3TC+AZT+IDV 26
3 3TC+D4T+SQV 57
4 AZT+DDI+NFV+RTV 13
5 3TC+AZT+NFV+RTV 209
6 Unknown 5

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M V11I L10V, I15V, K20T, E35D, M36I, I62V, L63P, H69K, A71T, I72V, T74S  
>RENA276| codons 1-99
PQITLWQRPVITIKVGGQLTEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGKKTVGSVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, V118I, I135V, E169D, K173A, Q174K, T200I, Q207E, R211K, F214L, V245Q, A272P, V276T, K277R, Q278H, T286A, E291D, V292I, I293V, P294T, E297A, V317A  
>RENA276| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRAKNPDIVI
YQYVDDLYVGSDLEIGQHRIKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKTRHLCKLLRGAKALTDIVTLTAEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009