<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RENA409 RENA409 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 48
2 D4T+DDI+EFV 61

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G16E, E35D, M36I, R41K, R57K, Q61N, E65D, I72T  
>RENA409| codons 1-99
PQITLWQRPLVTIKVEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NILIDICGHKATGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219Q K103N V108I E28K, K32E, V35M, T107S, D123E, S163C, E169D, K173A, Q174K, D177E, Q207E, R211K, H221Y, I244V, V245Q, E248D, A272P, K277R, T286A, E291D, V292I, I293V, P294T, E297P  
>RENA409| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVSILDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSCMTKILDPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDQKYQKEPPFLWMGYELHPDKWT
VQPVQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVTLTPEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009