<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
197 197 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 4
2 3TC+AZT 48
3 3TC+D4T 35
4 3TC+AZT+RTV 4
5 3TC+AZT+IDV 61
6 AZT+DDI+EFV+NFV 160

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215Y K219EQ K103N, G190S   K20R, V35VL, I135T, R211K, E248D, A272P, I293V, V314X Q145Q*
>197| codons 1-317
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALLEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRY*YNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVSSDLEIGQHRTKIEELRQHLLKWGFYTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPXHGV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I L10IV, L19V, A22AV, E35D, M36I, N37S, R41K, I62IV, L63P, I64V, A71V, T74S, I93L  
>197| codons 1-99
PQITLWQRPVVTIKIGGQVKEVLIDTGADDTVLEDISLPGKWKPKLIGGIGGFVKVRQYD
QVPVEICGHKVIGSVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009