<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
192 192 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 4
2 AZT+DDC 52
3 AZT+DDC+SQV 48
4 Unknown 4
5 3TC+D4T+SQV 100
6 3TC+AZT+EFV 91
7 3TC+AZT+NFV 67

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73S L10I, I13V, L63P, A71V, V77I, I93L  
>192| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVISTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215Y   K103N A98G, V108I E44D, V118I, K122E, D123E, I135L, I142T, E169D, K173A, Q174K, V179I, T200A, Q207E, H208Y, R211K, L228H, V245Q, E248D, A272P, I293V, E297A L109LP
>192| codons 1-299
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTIPDVGDAYFSIPL
DEEFRKYTAFTIPSLNNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILDPFRAKNPDIII
YQYVDDLYVGSDLEIGQHRAKIEELREYLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTAEA

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009