<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RENA496 RENA496 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 56
2 Unknown 4
3 3TC+AZT 104
4 Unknown 44
5 3TC+D4T+NVP 87
6 Unknown 4
7 D4T+DDI+NFV 72

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84C   L10V, E35D, M36I, R41K, L63P  
>RENA496| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNCIGRNLLTQIGCTLNF

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009