<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
13_05 13_05 Brazil 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36L, R41K, K45R, L63P, K70R, I93L  
>13_05| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDLNLPGKWKPRMIGGIGGFIKVRQYD
QIPIEICGHRAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009