<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RES327_03 RES327_03 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+RTV 43
2 D4T+DDI+NFV 57

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, R57K, D60E, Q61E, L63P, V77I, L89M  
>RES327_03| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYE
EIPIEICGHKAIGTVLIGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        S48T, K104R, V118I, D123E, D177N, R211K, F214L, V245L  
>RES327_03| codons 1-263
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPNIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPILLPEKDSWTVNDIQKLVGK

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009