<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12SP040760 12SP040760 Brazil 2004 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+IDV 257
2 3TC+D4T+IDV+RTV 2
3 3TC+D4T+IDV 59
4 3TC+D4T 65

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, V82A   T12Q, I15V, Q18L, L19P, K20M, E35D, M36I, R57K, Q61N, L63P, I64V, T74S, I93L  
>12SP040760| codons 1-99
PQITLWQRPLVQIKVGGLPMEALLDTGADDTVLEDINLPGRWKPKLIGGIGGFIKVKQYD
NIPVEICGHKAIGSVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       D121H, K122E, D123E, I135T, I142V, D177E, Q207E, A272P, I293V  
>12SP040760| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009