<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RENA578 RENA578 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 121
2 D4T+DDI+RTV+SQV 96
3 3TC+AZT+EFV+NFV 57
4 ABC+D4T+LPV 61

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54A, V82A L24I, L33F, Q58E L10I, E35D, M36I, R41K, K55R, R57K, D60E, Q61N, I62V, L63A, L89M  
>RENA578| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVFEDINLPGKWKPKIIGGIGGFARVKEYE
NVAIEICGHKAIGTVLVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       E28Q, K32EQ, V35T, T39A, V118I, K122E, I135T, D177N, Q207E, R211K, I293V, E297K, I326V  
>RENA578| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTQEKIQALTEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPNIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQG

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009