<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RES303_03 RES303_03 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC+RTV 157
2 Unknown 4
3 3TC+D4T+NVP 117

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A   L10I, K14R, I15V, L19I, K20R, E35D, M36I, R41K, R57K, Q61N, T74A, L89M  
>RES303_03| codons 1-99
PQITLWQRPIVTIRVGGQIREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVKQYD
NILIEICGHKAIGAVLVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V T215V, K219Q G190A K101H E28G, K122E, S162C, K166R, E169D, Q197K, T200A  
>RES303_03| codons 1-256
PISPIETVPVKLKPGMDGPKVKQWPLTGEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLHKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTRILDPFRKQNPDIVI
YQYVDDLYVASDLEIGKHRAKIEELRQHLLRWGFVTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVND

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009