<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RES299_03 RES299_03 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 35
2 3TC+AZT+NFV 104
3 D4T+DDI+NFV 35

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S   L10V, I15V, K20T, E35D, M36I, R41K, K45R, R57K, Q61N  
>RES299_03| codons 1-99
PQITLWQRPVVTIKVGGQLTEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
NILIEICGHKAIGTVLVGPTPVNIIGRSLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, L210W, T215Y K219E K103S, G190A   K101R, K122E, D123N, I135T, V245K  
>RES299_03| codons 1-252
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLRKSKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVASDLEIGQHRTKIEELRQHLWRWGFYTPDEKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSW

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009