<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RENA101 RENA101 Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 78

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V     V179D S48T, E79D, K102R, K122E, T139M, F214L, P243S, V245K, A272P, K281R, T286A, E297K, D324E, Q334E  
>RENA101| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRDLNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNEMPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIDI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQSIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGEG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  N88D V11VF, I15V, K20T, E35D, M36I, R41K, R57K, Q61D, I72V, V77I, L89M  
>RENA101| codons 1-99
PQITLWQRPLFTIKVGGQLTEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
DILIEICGHKAVGTVLIGPTPVNIIGRDMLTQIGCTLNF

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009