<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
pt25 ynFkAu5OC5 Germany 2004 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TP, I13V, K14KN, L19P, K20I, M36I, R41K, L63P, H69K, K70KR, L89I  
>ynFkAu5OC5| codons 1-99
PQITLWQRPLVPVNIGGQPIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKRAIGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I5V, V35T, V60I, S68G, T69TN, D121H, K122E, I135L, A158S, S162A, K173T, Q174K, D177E, I178IV, G196E, T200A, Q207E, R211K, V245Q K46K*
>ynFkAu5OC5| codons 1-260
PISPVETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEG*ISKIGPENPYNTPI
FAIKKKDGNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPSIFQASMTKILEPFRTKNPEVVI
YQYMDDLYVGSDLEIEQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKL

References
Author Title Citation
Vercauteren, J Transmission of drug-resistant HIV-1 is stabilizing in Europe. J Infect Dis, 2009