<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4334 CA14487 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 26
2 3TC+D4T+IDV 52
3 DDI+DLV+RTV+SQV 52
4 D4T+ADV+EFV+RTV+SQV 21
5 None 26
6 ABC+D4T+APV+NFV 26
7 3TC+ABC+D4T+APV 6

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, L74V, M184MV, L210W, T215Y K219N M230L V179D T39E, R83K, K103R, K122E, S162C, K173KR, I178IM, G196GE, E203D, H208HY, R211K, V245Q, T286A, V292I  
>CA14487| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICEELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKKTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRRQNPDMDI
YQYVDDLYVGSDLEIEQHRTKIDELRQYLWKWGFYTPDNKHQKEPPFLWLGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEIIPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M L33LI L10LI, L19I, K20IM, E35D, M36I, N37D, L63P, A71IT, P79PH, Q92QK  
>CA14594| codons 1-99
PQITLWQRPIVTIKIGGQIIEALLDTGADDTVIEDIDLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKIIGTVLVGPTPVNVIGRNLMTKIGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005