<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
pt108 UG89kINN2L Germany 2004 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F I13V, L19LV, K20V, M36I, P39V, R41K, L63V, H69K, L89IM  
>UG89kINN2L| codons 1-99
PQITLWQRPLVTVKIGGQVVEALLDTGADDTVFEEINLVGKWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, V60VI, K122E, I135V, S162A, K173T, Q174K, D177E, I178M, T200A, Q207D, R211K, P243Q, V245Q, K281R, T286A, E291D, V292I, I293V, P294T, S322T, I326V, G335D  
>UG89kINN2L| codons 1-341
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQQIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQDQWTYQI

References
Author Title Citation
Vercauteren, J Transmission of drug-resistant HIV-1 is stabilizing in Europe. J Infect Dis, 2009