<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
pt111 UcfT1kp56d Sweden 2005 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13AV, K14R, L19P, K20I, M36I, R41K, L63LP, H69K, V82I, L89M  
>UcfT1kp56d| codons 1-99
PQITLWQRPLVTVRIGGQPIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K20R, K32KR, V35T, K102Q, K122E, D123H, I135V, S162A, T165I, K173T, Q174K, D177E, I178M, I195L, T200A, Q207A, V245Q, E248V  
>UcfT1kp56d| codons 1-253
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIRALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DEHFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMIKILEPFRTKNPEMVI
YQYMDDLYVGSDLELGQHRAKIEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPVKDSWT

References
Author Title Citation
Vercauteren, J Transmission of drug-resistant HIV-1 is stabilizing in Europe. J Infect Dis, 2009